Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405842 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMN
TGTIC PLPELVKLKY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hereditary sensory and autonomic neuropathy type I in a Chinese family: British C133W mutation exists in the Chinese.
Bi H, Gao Y, Yao S, Dong M, Headley AP, Yuan Y
Neuropathology : official journal of the Japanese Society of Neuropathology 2007 Oct;27(5):429-33
Neuropathology : official journal of the Japanese Society of Neuropathology 2007 Oct;27(5):429-33
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting