Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310841 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRG
VTEHY GINIDDIDLI- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutant SPTLC1 dominantly inhibits serine palmitoyltransferase activity in vivo and confers an age-dependent neuropathy.
McCampbell A, Truong D, Broom DC, Allchorne A, Gable K, Cutler RG, Mattson MP, Woolf CJ, Frosch MP, Harmon JM, Dunn TM, Brown RH Jr
Human molecular genetics 2005 Nov 15;14(22):3507-21
Human molecular genetics 2005 Nov 15;14(22):3507-21
No comments: Submit comment
No validations: Submit validation data