HPA010860

SPTLC1 antibody from Sigma-Aldrich
hLCB1, HSAN1, HSN1, LCB1, SPTI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010860
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010860, RRID:AB_1080086
Product name
Anti-SPTLC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010860
Antibody type
Polyclonal
Antigen
Serine palmitoyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKD
HPALNYNIVSGPPSHKTVVNGKECINFASFNFLGL
LDNPRVKAAALASLKKYGVGTCGPR
Storage
-20C
Provider Type Product Number
- No reagents -