Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501248 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Early Growth Response 3 (EGR3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EGR3 antibody: synthetic peptide directed towards the middle region of human EGR3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQ
SAKPA LDSNLFPMIP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic analysis of the calcineurin pathway identifies members of the EGR gene family, specifically EGR3, as potential susceptibility candidates in schizophrenia.
Yamada K, Gerber DJ, Iwayama Y, Ohnishi T, Ohba H, Toyota T, Aruga J, Minabe Y, Tonegawa S, Yoshikawa T
Proceedings of the National Academy of Sciences of the United States of America 2007 Feb 20;104(8):2815-20
Proceedings of the National Academy of Sciences of the United States of America 2007 Feb 20;104(8):2815-20
No comments: Submit comment
No validations: Submit validation data