HPA006206

EGR3 antibody from Sigma-Aldrich
PILOT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006206
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006206, RRID:AB_10602491
Product name
Anti-EGR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006206
Antibody type
Polyclonal
Antigen
early growth response 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPM
IPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPI
TPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRK
YPNRPSKTPLHERPHACPAEGCDRRFSRSD
Storage
-20C
Provider Type Product Number
- No reagents -