HPA000827

POLR2F antibody from Sigma-Aldrich
HRBP14.4, RPB6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000827, RRID:AB_1079834
Product name
Anti-POLR2F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000827
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDDFDDVEEDEGLDDLENAEEEGQENVEILPSGER
PQANQKRITTPYMTKYERARVLGTRALQIAMCAPV
MVELEGETDPLLIAMKELKARKIPIIIRRYLPDGS
YEDWGVDELII
Storage
-20C
Provider Type Product Number
- No reagents -