HPA011897

SI antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011897, RRID:AB_1856840
Product name
Anti-SI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011897
Antibody type
Polyclonal
Antigen
Sucrase-isomaltase, intestinal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDP
VNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPW
CFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFG
NDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQ
YV
Storage
-20C
Provider Type Product Number
- No reagents -