Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00093624-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00093624-M08, RRID:AB_565956
- Product name
- MGC21874 monoclonal antibody (M08), clone 1C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MGC21874.
- Antigen sequence
AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECF
SAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWT
SREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEV
MEHY- Isotype
- IgG
- Antibody clone number
- 1C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J
Molecular and cellular biology 2009 Mar;29(5):1176-88
Molecular and cellular biology 2009 Mar;29(5):1176-88
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MGC21874 monoclonal antibody (M08), clone 1C8 Western Blot analysis of MGC21874 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MGC21874 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol