HPA028088

RAB11FIP3 antibody from Sigma-Aldrich
eferin, KIAA0665, Rab11-FIP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028088
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028088, RRID:AB_10601672
Product name
Anti-RAB11FIP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028088
Antibody type
Polyclonal
Antigen
RAB11 family interacting protein 3 (class II) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLSSKKVARYLHQSGALTMEALEDPSPELMEGPEE
DIADKVVFLERRVLELEKDTAATGEQHSRLRQENL
QLVHRANALEEQLKEQELRACEMVLE
Storage
-20C
Provider Type Product Number
- No reagents -