Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009990-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009990-A01, RRID:AB_607030
- Product name
- SLC12A6 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
- Antigen sequence
MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQD
SDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSN
YEEGDEYFDKNLALFEEEMD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Potassium-chloride cotransporter 3 interacts with Vav2 to synchronize the cell volume decrease response with cell protrusion dynamics.
Loss of neuronal potassium/chloride cotransporter 3 (KCC3) is responsible for the degenerative phenotype in a conditional mouse model of hereditary motor and sensory neuropathy associated with agenesis of the corpus callosum.
Transit defect of potassium-chloride Co-transporter 3 is a major pathogenic mechanism in hereditary motor and sensory neuropathy with agenesis of the corpus callosum.
HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- co-transporter 3.
Salin-Cantegrel A, Shekarabi M, Rasheed S, Charron FM, Laganière J, Gaudet R, Dion PA, Lapointe JY, Rouleau GA
PloS one 2013;8(5):e65294
PloS one 2013;8(5):e65294
Loss of neuronal potassium/chloride cotransporter 3 (KCC3) is responsible for the degenerative phenotype in a conditional mouse model of hereditary motor and sensory neuropathy associated with agenesis of the corpus callosum.
Shekarabi M, Moldrich RX, Rasheed S, Salin-Cantegrel A, Laganière J, Rochefort D, Hince P, Huot K, Gaudet R, Kurniawan N, Sotocinal SG, Ritchie J, Dion PA, Mogil JS, Richards LJ, Rouleau GA
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Mar 14;32(11):3865-76
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Mar 14;32(11):3865-76
Transit defect of potassium-chloride Co-transporter 3 is a major pathogenic mechanism in hereditary motor and sensory neuropathy with agenesis of the corpus callosum.
Salin-Cantegrel A, Rivière JB, Shekarabi M, Rasheed S, Dacal S, Laganière J, Gaudet R, Rochefort D, Lesca G, Gaspar C, Dion PA, Lapointe JY, Rouleau GA
The Journal of biological chemistry 2011 Aug 12;286(32):28456-65
The Journal of biological chemistry 2011 Aug 12;286(32):28456-65
HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- co-transporter 3.
Salin-Cantegrel A, Shekarabi M, Holbert S, Dion P, Rochefort D, Laganière J, Dacal S, Hince P, Karemera L, Gaspar C, Lapointe JY, Rouleau GA
Human molecular genetics 2008 Sep 1;17(17):2703-11
Human molecular genetics 2008 Sep 1;17(17):2703-11
No comments: Submit comment
No validations: Submit validation data