Antibody data

Product number
ABIN502595
Provider
antibodies-online
Product name
anti-Fms-Related tyrosine Kinase 3 Ligand (FLT3LG) (N-Term) antibody
Provider product page
antibodies-online - ABIN502595
Antibody type
Polyclonal
Antigen
The immunogen for anti-FLT3LG antibody: synthetic peptide directed towards the N terminal of human FLT3LG
Description
Affinity Purified
Reactivity
Human, Bovine, Canine
Host
Rabbit
Antigen sequence
TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSP
ISSDF AVKIRELSDY
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -