Antibody data

Product number
H00051763-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051763-M09, RRID:AB_1237863
Product name
INPP5K monoclonal antibody (M09), clone 3B4
Provider product page
Abnova Corporation - H00051763-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant INPP5K.
Antigen sequence
MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDL
LQLNNRNLNPDIYVIGLQELNSGIISLLSDAAFND
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQ
HLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEG
RDIPNILDHDLIIWFGDMNFRIEDFGLRFVRESIK
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPP
TYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVS
GTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDS
KVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI
Isotype
IgG
Antibody clone number
3B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -