HPA011960

CAPN15 antibody from Sigma-Aldrich
SOLH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011960, RRID:AB_10610556
Product name
Anti-SOLH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011960
Antibody type
Polyclonal
Antigen
small optic lobes homolog (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGL
VATEPARGQCEDKDEEEKEEQEEEEGAAEPRGGWA
CPRCTLHNTPVASSCSVCGGPRRLSLPRIPPEALV
VPE
Storage
-20C
Provider Type Product Number
- No reagents -