Antibody data

Product number
PAB20513
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20513, RRID:AB_10965714
Product name
DNAJB11 polyclonal antibody
Provider product page
Abnova Corporation - PAB20513
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DNAJB11.
Antigen sequence
EPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVK
HPIFERRGDDLYTNVTISLVESLVGFEMDITHLDG
HKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGS
LIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVY
NGLQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -