HPA010814

DNAJB11 antibody from Sigma-Aldrich
EDJ, ERdj3, HEDJ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010814
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010814, RRID:AB_1078691
Product name
Anti-DNAJB11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010814
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVK
HPIFERRGDDLYTNVTISLVESLVGFEMDITHLDG
HKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGS
LIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVY
NGLQ
Storage
-20C
Provider Type Product Number
- No reagents -