HPA017051

DNAJB11 antibody from Sigma-Aldrich
EDJ, ERdj3, HEDJ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017051
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017051, RRID:AB_1847792
Product name
Anti-DNAJB11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017051
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDF
GFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAG
NFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPG
RFQMTQEVVCDECPNVKLVNEERTLEV
Storage
-20C
Provider Type Product Number
- No reagents -