WH0055520M1

ELAC1 antibody from Sigma-Aldrich
D29
ELISA
Recommended by provider

Antibody data

Product number
WH0055520M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0055520M1, RRID:AB_2096541
Product name
Monoclonal Anti-ELAC1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0055520M1
Antibody type
Monoclonal
Antigen
ELAC1 (NP_061166, a.a. 282-363) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
QMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQ
RYKPVALAREGETDGIAELKKQAESVLDLQEVTLA
EDFMVISIPIK* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -