SAB2100673

ELAC1 antibody from Sigma-Aldrich
D29
No application information provided.

Antibody data

Product number
SAB2100673
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100673, RRID:AB_10600270
Product name
Anti-ELAC1 (ab1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100673
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_061166.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGP
AYGKLKNGISVVLEN
Storage
-20C
Provider Type Product Number
- No reagents -