HPA035808

ABLIM2 antibody from Sigma-Aldrich
KIAA1808
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035808
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA035808, RRID:AB_10601962
Product name
Anti-ABLIM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA035808
Antibody type
Polyclonal
Antigen
actin binding LIM protein family, member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLDT
QSLSHSSGTDRDPLQRMAGDSFHSRFPYSKSDPLP
GHGKNGLDQRNANLAPCGADPDAS
Storage
-20C
Provider Type Product Number
- No reagents -