H00254531-B01P

LPCAT4 antibody from Abnova Corporation
AGPAT7, AYTL3, FLJ10257, LPAAT-eta, LPEAT2

Antibody data

Product number
H00254531-B01P
Provider
Abnova Corporation
Product name
LPCAT4 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00254531-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LPCAT4 protein.
Antigen sequence
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQ
RVKFCLLGALLAPIRVLLAFIVLFLLWPFAWLQVA
GLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLG
FLRIRVRGQRASRLQAPVLVAAPHSTFFDPIVLLP
CDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDP
ASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKK
ALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWR
GPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESR
DPTLYANNVQRVMAQALGIPATECEFVGSLPVIVV
GRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPG
RSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKG
LVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAEL
CQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPP
HTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -