HPA031474

MTUS2 antibody from MilliporeSigma / Merck KGaA
CAZIP, ICIS, KIAA0774, TIP150
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031474
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031474, RRID:AB_10600109
Product name
Anti-KIAA0774 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031474
Antibody type
Polyclonal
Antigen
microtubule associated tumor suppressor candidate 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSVLNIPAPLHPETTVNMTYQPTTPSSSFQDVSVF
GMDAGSPLVVPPPTDSARLLNTSPKVPDKNTCPSG
IPKPVFTHSKDTPSSQEGMENYQV
Storage
-20C
Provider Type Product Number
- No reagents -