HPA010815

GLG1 antibody from Atlas Antibodies
CFR-1, ESL-1, MG-160
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010815
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010815, RRID:AB_2232486
Product name
Anti-GLG1
Provider product page
Atlas Antibodies - HPA010815
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVE
ECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPV
LHTACALDIKHHCAAITPGRGRQMSCLMEALEDKR
VRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAM
QVMTSPSKNY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -