HPA010815

GLG1 antibody from Sigma-Aldrich
CFR-1, ESL-1, MG-160
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010815, RRID:AB_2232486
Product name
Anti-GLG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010815
Antibody type
Polyclonal
Antigen
Golgi apparatus protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVE
ECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPV
LHTACALDIKHHCAAITPGRGRQMSCLMEALEDKR
VRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAM
QVMTSPSKNY
Storage
-20C
Provider Type Product Number
- No reagents -