Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036119 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036119, RRID:AB_10673000
- Product name
- Anti-CHMP7
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYA
SQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVD
QIQELCDTQDEVSQTL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NFκB and JNK pathways mediate metabolic adaptation upon ESCRT-I deficiency.
Identification of PIM1 substrates reveals a role for NDRG1 phosphorylation in prostate cancer cellular migration and invasion
Automated analysis of cell migration and nuclear envelope rupture in confined environments
LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells
Cendrowski J, Wrobel M, Mazur M, Jary B, Maurya R, Wang S, Korostynski M, Dziewulska A, Rohm M, Kuropka P, Pudelko-Malik N, Mlynarz P, Dobrzyn A, Zeigerer A, Miaczynska M
Cellular and molecular life sciences : CMLS 2024 Nov 19;81(1):458
Cellular and molecular life sciences : CMLS 2024 Nov 19;81(1):458
Identification of PIM1 substrates reveals a role for NDRG1 phosphorylation in prostate cancer cellular migration and invasion
Ledet R, Ruff S, Wang Y, Nayak S, Schneider J, Ueberheide B, Logan S, Garabedian M
Communications Biology 2021;4(1)
Communications Biology 2021;4(1)
Automated analysis of cell migration and nuclear envelope rupture in confined environments
Ramchandran R, Elacqua J, McGregor A, Lammerding J
PLOS ONE 2018;13(4):e0195664
PLOS ONE 2018;13(4):e0195664
LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells
Gu M, LaJoie D, Chen O, von Appen A, Ladinsky M, Redd M, Nikolova L, Bjorkman P, Sundquist W, Ullman K, Frost A
Proceedings of the National Academy of Sciences 2017;114(11)
Proceedings of the National Academy of Sciences 2017;114(11)
No comments: Submit comment
No validations: Submit validation data