Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310511 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC7A1 antibody: synthetic peptide directed towards the N terminal of human SLC7A1
- Description
- Affinity Purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNN
DTKEG KPGVGGFMPF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Polyamines upregulate the mRNA expression of cationic amino acid transporter-1 in human retinal pigment epithelial cells.
Kaneko S, Okuda-Ashitaka E, Ando A, Nishimura K, Igarashi K, Maeda M, Furuta K, Suzuki M, Matsumura M, Ito S
American journal of physiology. Cell physiology 2007 Aug;293(2):C729-37
American journal of physiology. Cell physiology 2007 Aug;293(2):C729-37
No comments: Submit comment
No validations: Submit validation data