HPA001187

TSSK4 antibody from Sigma-Aldrich
C14orf20, STK22E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001187, RRID:AB_10602485
Product name
Anti-TSSK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001187
Antibody type
Polyclonal
Antigen
testis-specific serine kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWSSDTILCLSPYFGLCSQLHGFPSSLPCALIMVS
TSHFLCPHLYPLTPGPSAPSLKLSPLPSLMPSLSA
AGRDLKLENLLLDKWENVKISDFGFAKMVPSNQPV
GCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLP
YNPF
Storage
-20C
Provider Type Product Number
- No reagents -