HPA013196

IL5RA antibody from Sigma-Aldrich
CD125, CDw125, IL5R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013196
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013196, RRID:AB_1846234
Product name
Anti-IL5RA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013196
Antibody type
Polyclonal
Antigen
Interleukin-5 receptor subunit alpha precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLF
ALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFP
IHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDL
SKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEH
KP
Storage
-20C
Provider Type Product Number
- No reagents -