HPA009078

TMEM230 antibody from Sigma-Aldrich
C20orf30, HSPC274
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009078
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009078, RRID:AB_1078345
Product name
Anti-C20orf30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009078
Antibody type
Polyclonal
Antigen
UPF0414 transmembrane protein C20orf30 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWSLVLSPRLEPSGVISAHCNLHLLASSDSSASAS
RLCQRVMMPSRTNLATGIPSSKVKYSRLSSTDDGY
IDLQFKKTPPKIPYK
Storage
-20C
Provider Type Product Number
- No reagents -