Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004017-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004017-M01, RRID:AB_606536
- Product name
- LOXL2 monoclonal antibody (M01), clone 5D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LOXL2.
- Antigen sequence
NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYL
FQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMY
NCHIGGSFSEETEKKFEHFSGLLNNQLSP- Isotype
- IgG
- Antibody clone number
- 5D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reduced nuclear and ectopic cytoplasmic expression of lysyl oxidase-like 2 is associated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma.
Epithelial-mesenchymal transition induced by hepatitis C virus core protein in cholangiocarcinoma.
Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
Li TY, Xu LY, Wu ZY, Liao LD, Shen JH, Xu XE, Du ZP, Zhao Q, Li EM
Human pathology 2012 Jul;43(7):1068-76
Human pathology 2012 Jul;43(7):1068-76
Epithelial-mesenchymal transition induced by hepatitis C virus core protein in cholangiocarcinoma.
Li T, Li D, Cheng L, Wu H, Gao Z, Liu Z, Jiang W, Gao YH, Tian F, Zhao L, Wang S
Annals of surgical oncology 2010 Jul;17(7):1937-44
Annals of surgical oncology 2010 Jul;17(7):1937-44
Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
Fujimoto E, Tajima S
Journal of dermatological science 2009 Aug;55(2):91-8
Journal of dermatological science 2009 Aug;55(2):91-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LOXL2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol