Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036257 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036257, RRID:AB_2675025
- Product name
- Anti-LOXL2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQ
VEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Data-Driven Kidney Transplant Phenotyping as a Histology-Independent Framework for Biomarker Discovery
Buscher K, Heitplatz B, van Marck V, Song J, Loismann S, Rixen R, Hüchtmann B, Kurian S, Ehinger E, Wolf D, Ley K, Pavenstädt H, Reuter S
Journal of the American Society of Nephrology 2021;32(8):1933-1945
Journal of the American Society of Nephrology 2021;32(8):1933-1945
No comments: Submit comment
No validations: Submit validation data