HPA009079

CFAP61 antibody from Sigma-Aldrich
C20orf26, CaM-IP3, dJ1002M8.3, DKFZP434K156
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009079, RRID:AB_1078344
Product name
Anti-C20orf26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009079
Antibody type
Polyclonal
Antigen
Uncharacterized protein C20orf26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCF
NDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLST
DEIVPYDHLILCTGQQYQVPCPTEADISQHLTNRE
VPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRN
NSITTE
Storage
-20C
Provider Type Product Number
- No reagents -