HPA010817

FXYD5 antibody from Sigma-Aldrich
OIT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010817, RRID:AB_1849214
Product name
Anti-FXYD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010817
Antibody type
Polyclonal
Antigen
FXYD domain-containing ion transport regulator 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPT
PTWPADETPQPQTQTQQLEGTDGPLVTDPETHKST
KAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFH
EDDPFFYDEHTLR
Storage
-20C
Provider Type Product Number
- No reagents -