H00010808-B01P

HSPH1 antibody from Abnova Corporation
HSP105A, HSP105B, KIAA0201, NY-CO-25

Antibody data

Product number
H00010808-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010808-B01P, RRID:AB_1576120
Product name
HSPH1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010808-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HSPH1 protein.
Antigen sequence
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCT
PSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRF
HGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMY
MGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDC
VISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMT
AVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQV
SACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFC
AEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSN
STDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQ
KIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAV
KERIAKFFGKDISTTLNADEAVARGCALQCAILSP
AFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYP
EAKIGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIF
TISTASMVEKVPTEENEMSSEADMECLNQRPPENP
DTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPEL
TSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVE
LPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKE
RNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNF
LRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGT
PVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRN
KDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQA
KKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKP
KIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH
QNGECYPNEKNSVNMDLD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -