HPA036949

antibody from Atlas Antibodies

Targeting: RAI14 DKFZp564G013, KIAA1334, NORPEG, RAI13

Antibody data

Submit

Validation data

Product number: HPA036949 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036949, RRID:AB_10670568
Product name: Anti-RAI14
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKA EISSIRENKDRLSDSTTGADSLLDISSEADQQDLL SLLQAKVASLTLHNKELQDK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RAI14 protein structure - HPA036949 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines U2OS and MCF-7 using Anti-RAI14 antibody. Corresponding RAI14 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-RAI14 antibody HPA036949 (A) shows similar pattern to independent antibody HPA036950 (B).
Antibody #2 product nr: HPA036950
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Sample type: MOUSE

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.