HPA031619

ATN1 antibody from Sigma-Aldrich
B37, D12S755E, DRPLA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031619
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031619, RRID:AB_10601667
Product name
Anti-ATN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031619
Antibody type
Polyclonal
Antigen
atrophin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAG
PNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGA
PYPFPPVPTVTTSSATLSTVIATVASSPAGYKTAS
PPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRT
GTPPGY
Storage
-20C
Provider Type Product Number
- No reagents -