H00113246-A01

C12orf57 antibody from Abnova Corporation
C10, GRCC10
No application information provided.

Antibody data

Product number
H00113246-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00113246-A01, RRID:AB_1139204
Product name
C12orf57 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00113246-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant C12orf57.
Antigen sequence
MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVR
MDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYG
FSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKAL
FLPPMTLPPHGPAAGGSVAAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -