Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010917 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TREM2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Do Alzheimer's Disease Risk Gene Products Actually Act in Microglia?
TREM2 expression in the human brain: a marker of monocyte recruitment?
A survey of TREM2 antibodies reveals neuronal but not microglial staining in formalin-fixed paraffin-embedded postmortem Alzheimer's brain tissues
The immunoreceptor tyrosine-based activation motif (ITAM) -related factors are increased in synovial tissue and vasculature of rheumatoid arthritic joints
Hashioka S, Inoue K, Takeshita H, Inagaki M
Frontiers in Aging Neuroscience 2020;12
Frontiers in Aging Neuroscience 2020;12
TREM2 expression in the human brain: a marker of monocyte recruitment?
Fahrenhold M, Rakic S, Classey J, Brayne C, Ince P, Nicoll J, Boche D
Brain Pathology 2017;28(5):595-602
Brain Pathology 2017;28(5):595-602
A survey of TREM2 antibodies reveals neuronal but not microglial staining in formalin-fixed paraffin-embedded postmortem Alzheimer's brain tissues
Satoh J, Kawana N, Yamamoto Y, Ishida T, Saito Y, Arima K
Alzheimer's Research & Therapy 2013;5(4):30
Alzheimer's Research & Therapy 2013;5(4):30
The immunoreceptor tyrosine-based activation motif (ITAM) -related factors are increased in synovial tissue and vasculature of rheumatoid arthritic joints
Crotti T, Dharmapatni A, Alias E, Zannettino A, Smith M, Haynes D
Arthritis Research & Therapy 2012;14(6)
Arthritis Research & Therapy 2012;14(6)
No comments: Submit comment
No validations: Submit validation data