HPA012571

TREM2 antibody from Sigma-Aldrich
TREM-2, Trem2a, Trem2b, Trem2c
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012571
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012571, RRID:AB_1858260
Product name
Anti-TREM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012571
Antibody type
Polyclonal
Antigen
Triggering receptor expressed on myeloid cells 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTH
NLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQP
HDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRD
AGDLWFP
Storage
-20C
Provider Type Product Number
- No reagents -