Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012571 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012571, RRID:AB_1858260
- Product name
- Anti-TREM2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTH
NLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQP
HDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRD
AGDLWFP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differential perivascular microglial activation in the deep white matter in vascular dementia developed post‐stroke
Gene expression and functional deficits underlie TREM2-knockout microglia responses in human models of Alzheimer’s disease
Hase Y, Ameen‐Ali K, Waller R, Simpson J, Stafford C, Mahesh A, Ryan L, Pickering L, Bodman C, Hase M, Boche D, Horsburgh K, Wharton S, Kalaria R
Brain Pathology 2022;32(6)
Brain Pathology 2022;32(6)
Gene expression and functional deficits underlie TREM2-knockout microglia responses in human models of Alzheimer’s disease
McQuade A, Kang Y, Hasselmann J, Jairaman A, Sotelo A, Coburn M, Shabestari S, Chadarevian J, Fote G, Tu C, Danhash E, Silva J, Martinez E, Cotman C, Prieto G, Thompson L, Steffan J, Smith I, Davtyan H, Cahalan M, Cho H, Blurton-Jones M
Nature Communications 2020;11(1)
Nature Communications 2020;11(1)
No comments: Submit comment
No validations: Submit validation data