Antibody data

Product number
PAB22742
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22742, RRID:AB_10963194
Product name
CPZ polyclonal antibody
Provider product page
Abnova Corporation - PAB22742
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human CPZ.
Description
Rabbit polyclonal antibody raised against recombinant CPZ.
Reactivity
Human
Host
Rabbit
Antigen sequence
GCEFERNPAGECHRPPAADSATCVDLQLRTCSDAA
YNHTTFPNLLQHRSWEVVEASSEYILLSVLHQLLE
GQCNPDL
Isotype
IgG
Vial size
100 μL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -