H00010273-M01

STUB1 antibody from Abnova Corporation
CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1

Antibody data

Product number
H00010273-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010273-M01, RRID:AB_1707200
Product name
STUB1 monoclonal antibody (M01), clone 2E12
Provider product page
Abnova Corporation - H00010273-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STUB1.
Antigen sequence
HDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFE
LMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRS
PLTQEQLIPNLAMKEVIDAFISENGWVEDY
Isotype
IgG
Antibody clone number
2E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -