Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502339 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-STIP1 Homology and U-Box Containing Protein 1 (STUB1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STUB1 antibody: synthetic peptide directed towards the C terminal of human STUB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VDEKRKKRDIPDYLCGKISFELMREPCITPSGITY
DRKDI EEHLQRVGHF- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CHIP-mediated degradation and DNA damage-dependent stabilization regulate base excision repair proteins.
Parsons JL, Tait PS, Finch D, Dianova II, Allinson SL, Dianov GL
Molecular cell 2008 Feb 29;29(4):477-87
Molecular cell 2008 Feb 29;29(4):477-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting