ABIN1109269
antibody from antibodies-online
Targeting: TMED1
Il1rl1l, IL1RL1LG, MGC1270, p24g1, p24gamma1, ST2L
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109269 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N-terminal region of rat Tmed1
- Description
- Immunoaffinity column
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLE
TEYQVIGGAGLDVDF- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HEK-293; . Lanes: Lane 1 and 2: 30 ug HEK-293 cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Anti-Rabbit HRP. Secondary Antibody Dilution: 1:2000. Gene Name: Tmed1. Submitted by: Anonymous.; Tmed1 antibody - N-terminal region (AP46054PU-N) in Human HEK-293 cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Rat Lung; WB Suggested Anti-Tmed1 Antibody. . Titration: 1.0 ug/ml. . Positive Control: Rat Lung; Tmed1 antibody - N-terminal region (AP46054PU-N) in Rat Lung cells using Western Blot