HPA018507

TMED1 antibody from Sigma-Aldrich
Il1rl1l, IL1RL1LG, MGC1270, p24g1, p24gamma1, ST2L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018507
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018507, RRID:AB_1858063
Product name
Anti-TMED1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018507
Antibody type
Polyclonal
Antigen
Transmembrane emp24 domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQ
VIGGAGLDVDFTLESPQGVLLVSESRKADG
Storage
-20C
Provider Type Product Number
- No reagents -