Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311150 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RABGGTA antibody: synthetic peptide directed towards the N terminal of human RABGGTA
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDS
GPQGR LPEDVLLKEL- Vial size
- 50 µg
Submitted references Rab-geranylgeranyl transferase regulates glucose-stimulated insulin secretion from pancreatic β cells.
Regulation of β2-adrenergic receptor maturation and anterograde trafficking by an interaction with Rab geranylgeranyltransferase: modulation of Rab geranylgeranylation by the receptor.
Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
Arora DK, Syed I, Machhadieh B, McKenna CE, Kowluru A
Islets 2012 Sep-Oct;4(5):354-8
Islets 2012 Sep-Oct;4(5):354-8
Regulation of β2-adrenergic receptor maturation and anterograde trafficking by an interaction with Rab geranylgeranyltransferase: modulation of Rab geranylgeranylation by the receptor.
Lachance V, Cartier A, Génier S, Munger S, Germain P, Labrecque P, Parent JL
The Journal of biological chemistry 2011 Nov 25;286(47):40802-13
The Journal of biological chemistry 2011 Nov 25;286(47):40802-13
Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
Hassel S, Eichner A, Yakymovych M, Hellman U, Knaus P, Souchelnytskyi S
Proteomics 2004 May;4(5):1346-58
Proteomics 2004 May;4(5):1346-58
No comments: Submit comment
No validations: Submit validation data