Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504430 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Jumonji Domain Containing 8 (JMJD8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-JMJD8 antibody: synthetic peptide directed towards the middle region of human LOC339123
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQ
DPTSL GNDTLYFFGD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR
Human molecular genetics 2001 Feb 15;10(4):339-52
Human molecular genetics 2001 Feb 15;10(4):339-52
No comments: Submit comment
No validations: Submit validation data