HPA012777

CBARP antibody from Sigma-Aldrich
BARP, C19orf26, DOS, MGC40084
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012777, RRID:AB_2067005
Product name
Anti-C19orf26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012777
Antibody type
Polyclonal
Antigen
Protein Dos recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGE
DPECQDAETERFLSTSSTGRRVSFNEAALFEQSRK
TQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVT
IHECD
Storage
-20C
Provider Type Product Number
- No reagents -