HPA012777

CBARP antibody from Atlas Antibodies
BARP, C19orf26, DOS, MGC40084
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012777
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012777, RRID:AB_1233602
Product name
Anti-CBARP
Provider product page
Atlas Antibodies - HPA012777
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGE
DPECQDAETERFLSTSSTGRRVSFNEAALFEQSRK
TQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVT
IHECD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -