WH0027299M1

ADAMDEC1 antibody from Sigma-Aldrich
M12.219
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0027299M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0027299M1, RRID:AB_1839381
Product name
Monoclonal Anti-ADAMDEC1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0027299M1
Antibody type
Monoclonal
Antigen
ADAMDEC1 (NP_055294, a.a. 361-471) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAH
FERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEV
GEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAP
NHTTE* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -