Antibody data

Product number
H00027299-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027299-M01, RRID:AB_605905
Product name
ADAMDEC1 monoclonal antibody (M01), clone 6C4
Provider product page
Abnova Corporation - H00027299-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ADAMDEC1.
Antigen sequence
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAH
FERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEV
GEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAP
NHTTE
Isotype
IgG
Antibody clone number
6C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -